Home | Franklin Pharmacy Inc (330) 369-4567 | Warren, OH #16,106,694 (
0%)
franklinpharmacyandhealthcare.com has a global rank of #16,106,694 which puts itself among the top 30 million most popular websites worldwide.
franklinpharmacyandhealthcare.com rank has been stable with no relevant variation over the last 3 months. franklinpharmacyandhealthcare.com was launched at August 15, 2003 and is 21 years and 204 days. It reaches roughly 870 users and delivers about 1,980 pageviews each month. Its estimated monthly revenue is $5.70. We estimate the value of franklinpharmacyandhealthcare.com to be around $69.35. The domain franklinpharmacyandhealthcare.com uses a Commercial suffix and its server(s) are located in United States with the IP number 146.88.98.18. franklinpharmacyandhealthcare.com is not listed on Dmoz.
Webmaster and SEO Tools
SEO Tools > Keyword Density Check
CloseWorth & Traffic Estimate of franklinpharmacyandhealthcare.com
Estimated numbers for franklinpharmacyandhealthcare.com - Niche: General - Average CPM: $2.80
For publishers it means average earnings for each 1k impressions.
Example: A website with a $3 CPM and 10000 impressions/pageviews a day is making on average $30 dollars a day.
Daily
Monthly
Yearly
Website Worth: $69.35
Daily Pageviews: 66
Daily Visitors: 29
Daily Ads Revenue: $0.19
Daily Pageviews: 66
Daily Visitors: 29
Daily Ads Revenue: $0.19
Website Worth: $69.35
Monthly Pageviews: 1,980
Monthly Visitors: 870
Monthly Ads Revenue: $5.70
Monthly Pageviews: 1,980
Monthly Visitors: 870
Monthly Ads Revenue: $5.70
Website Worth: $69.35
Yearly Pageviews: 24,090
Yearly Visitors: 10,585
Yearly Ads Revenue: $69.35
Yearly Pageviews: 24,090
Yearly Visitors: 10,585
Yearly Ads Revenue: $69.35
Choose a specific category/niche
The value and earnings of a website just like a physical company also depends on the market it's focusing.
A Humor blog for example usually have low value for potential advertisers while a Finance one have a higher value since it usually has more visitors willing to buy expensive services/products and this consequently affects a website average earnings per visitors so as market worth.
Automobile
Average High priced niches
Average Low priced niches
B2B
Banking and Finance
Books & Online content
Consumer durables
Dating
Education
Entertainment
Fashion and Clothing
Fitness
Food
Gaming
General
Hotels and Travel
IT hardware
Jobs
Legal
Machinery or equipment
Medical treatment
Medicines
Miracle drugs or vitamins
Music
News Portals
Random blogs or content
Real Estate
Religion
Science
Shopping Portals
Social networks
Sports
Technology
Webmaster & Web Hosting

A Humor blog for example usually have low value for potential advertisers while a Finance one have a higher value since it usually has more visitors willing to buy expensive services/products and this consequently affects a website average earnings per visitors so as market worth.

$4.30

$8.00

$2.00

$8.00

$12.00

$2.00

$3.00

$3.50

$9.00

$1.00

$1.50

$6.00

$4.00

$1.50

$2.80

$3.50

$6.00

$2.50

$15.00

$3.00

$8.00

$4.00

$3.50

$1.00

$10.00

$1.00

$7.20

$1.70

$4.50

$2.50

$0.70

$2.00

$8.50

$12.00
Main Information of franklinpharmacyandhealthcare.com
Information of franklinpharmacyandhealthcare.com
- Alexa Rank:16,106,694 (
0% over the last 3 months)
The Alexa rank is a measure of franklinpharmacyandhealthcare.com's popularity.
The lower the rank is, the more popular the website is. This rank is calculated using a combination of average daily visitors and pageviews from franklinpharmacyandhealthcare.com over the last 3 months.
Google.com ranks #1 for example. - Quantcast Rank:Not ranked/Not available
The Quantcast rank is a measure of franklinpharmacyandhealthcare.com's popularity.
The lower the rank is, the more popular the website is. This rank is calculated using a combination of average daily visitors and pageviews from franklinpharmacyandhealthcare.com over the last 3 months.
Google.com ranks #1 for example. - Google Pagerank:Not ranked/Not available
Google PageRank reflects the importance of web pages by considering more than 500 million variables and 2 billion terms. Pages that Google search engine believes are important receive a higher PageRank and are more likely to appear at the top of the search results.
PageRank also considers the importance of each page that casts a vote, as votes from some pages are considered to have greater value, thereby giving the linked page a greater value. - IP Address:146.88.98.18
IP Addresses are similar to physical addresses. It's a number that represents the identification and location of a website. Every computer has an IP address. - IP Tracing
- Site Age:21 years and 204 days
- Created:2003-08-15
- Expires:2019-08-15
- Updated:2018-07-17
- Owner:Unknown
- ICANN Registrar:eNom, LLC
This shows the company who handled the registration of this domain.
- Hosted in:United States
- Domain Suffix:Commercial
A domain suffix is the last part of a domain name and is often referred to as a "top-level domain" or TLD.
.COM is the most popular and it represents Commercial websites.
DNS Records of franklinpharmacyandhealthcare.com
Host | Type | TTL | Extra |
---|---|---|---|
franklinpharmacyandhealthcare.com | A | 1799 | IP: 146.88.98.18 |
franklinpharmacyandhealthcare.com | NS | 0 | Target: dns3.name-services.com |
franklinpharmacyandhealthcare.com | NS | 0 | Target: dns2.name-services.com |
franklinpharmacyandhealthcare.com | NS | 0 | Target: dns1.name-services.com |
franklinpharmacyandhealthcare.com | NS | 0 | Target: dns4.name-services.com |
franklinpharmacyandhealthcare.com | NS | 0 | Target: dns5.name-services.com |
franklinpharmacyandhealthcare.com | SOA | 3600 | MNAME: dns1.name-services.com RNAME: info.name-services.com Serial: 1522437588 Refresh: 172800 Retry: 900 Expire: 1814400 Minimum TTL: 3600 |
franklinpharmacyandhealthcare.com | MX | 1800 | Priority: 10 Target: mail.mysecurescripts.com |
Name Servers of franklinpharmacyandhealthcare.com
dns1.name-services.com
dns2.name-services.com
dns3.name-services.com
dns4.name-services.com
dns5.name-services.com
Header Info of franklinpharmacyandhealthcare.com
franklinpharmacyandhealthcare.com is using Apache as server.
This website also uses compressing module Gzip to load pages faster.
Header | HTTP1.1 206 Partial Content |
Date | Thu, 25 Apr 2019 080028 GMT |
Server | Apache |
Expires | Thu, 19 Nov 1981 085200 GMT |
Cache-Control | no-store, no-cache, must-revalidate |
Pragma | no-cache |
Set-Cookie | PHPSESSID=071937420ac3afb74aa0955ceccc1551; path=; secure; HttpOnly Set-Cookie mobile_app=true; expires=Fri, 26-Apr-2019 080028 GMT; Max-Age=86400 |
Vary | Accept-Encoding |
Content-Encoding | gzip |
Content-Range | bytes 0-94589459 |
Content-Length | 9459 |
Connection | close |
Content-Type | texthtml; charset=UTF-8 |
Search Engine & Internet Presense of franklinpharmacyandhealthcare.com
A website with a large amount of indexed pages in search engines is more likely to have tons of visits.If you are buying franklinpharmacyandhealthcare.com or it is your competitor checking how many pages indexed it has is vital.
If franklinpharmacyandhealthcare.com has no pages indexed it means it's too new, is banned or suffered a penalty.
Internet Presense of franklinpharmacyandhealthcare.com
- Backlinks: Not available for this website.
- Google Indexed Pages:View
This represents how many pages from franklinpharmacyandhealthcare.com are currently visible to the public on Google search engine.
- Yahoo Indexed Pages:View
This represents how many pages from franklinpharmacyandhealthcare.com are currently visible to the public on Yahoo search engine.
- Bing Indexed Pages:View
This represents how many pages from franklinpharmacyandhealthcare.com are currently visible to the public on Bing search engine.
- Dmoz Listing:No
- Dmoz Title:None
- Dmoz Description:None
- Web Archive:franklinpharmacyandhealthcare.com (in the past).
Statistical Graphics of franklinpharmacyandhealthcare.com
Select an option below to analyse several graphic statistics.
Compare this website to:
Period:
IP Tracing of franklinpharmacyandhealthcare.com
- franklinpharmacyandhealthcare.com is hosted by National Radio Astronomy Observatory in Socorro, New Mexico.
- Country:United States
- City:Socorro
- Region:New Mexico
- Latitude:33.8974
- Longitude:-107.0261
- ASNum:AS17153 New Mexico Institute of Mining and Technology
- ISP:National Radio Astronomy Observatory
- Organization:National Radio Astronomy Observatory
- Postcode:87801
Similar Domain Names of franklinpharmacyandhealthcare.com
cranklinpharmacyandhealthcare.com, dranklinpharmacyandhealthcare.com, eranklinpharmacyandhealthcare.com, rranklinpharmacyandhealthcare.com, tranklinpharmacyandhealthcare.com, granklinpharmacyandhealthcare.com, branklinpharmacyandhealthcare.com, vranklinpharmacyandhealthcare.com, feanklinpharmacyandhealthcare.com, fdanklinpharmacyandhealthcare.com, ffanklinpharmacyandhealthcare.com, fganklinpharmacyandhealthcare.com, ftanklinpharmacyandhealthcare.com, frqnklinpharmacyandhealthcare.com, frwnklinpharmacyandhealthcare.com, frznklinpharmacyandhealthcare.com, frxnklinpharmacyandhealthcare.com, frabklinpharmacyandhealthcare.com, fragklinpharmacyandhealthcare.com, frahklinpharmacyandhealthcare.com, frajklinpharmacyandhealthcare.com, framklinpharmacyandhealthcare.com, franulinpharmacyandhealthcare.com, franjlinpharmacyandhealthcare.com, franmlinpharmacyandhealthcare.com, franllinpharmacyandhealthcare.com, franolinpharmacyandhealthcare.com, frankpinpharmacyandhealthcare.com, frankoinpharmacyandhealthcare.com, frankiinpharmacyandhealthcare.com, frankkinpharmacyandhealthcare.com, frankminpharmacyandhealthcare.com, franklunpharmacyandhealthcare.com, frankljnpharmacyandhealthcare.com, franklknpharmacyandhealthcare.com, frankllnpharmacyandhealthcare.com, franklonpharmacyandhealthcare.com, franklibpharmacyandhealthcare.com, frankligpharmacyandhealthcare.com, franklihpharmacyandhealthcare.com, franklijpharmacyandhealthcare.com, franklimpharmacyandhealthcare.com, franklinoharmacyandhealthcare.com, franklinlharmacyandhealthcare.com, franklinpbarmacyandhealthcare.com, franklinpgarmacyandhealthcare.com, franklinptarmacyandhealthcare.com, franklinpyarmacyandhealthcare.com, franklinpuarmacyandhealthcare.com, franklinpjarmacyandhealthcare.com, franklinpmarmacyandhealthcare.com, franklinpnarmacyandhealthcare.com, franklinphqrmacyandhealthcare.com, franklinphwrmacyandhealthcare.com, franklinphzrmacyandhealthcare.com, franklinphxrmacyandhealthcare.com, franklinphaemacyandhealthcare.com, franklinphadmacyandhealthcare.com, franklinphafmacyandhealthcare.com, franklinphagmacyandhealthcare.com, franklinphatmacyandhealthcare.com, franklinpharnacyandhealthcare.com, franklinpharhacyandhealthcare.com, franklinpharjacyandhealthcare.com, franklinpharkacyandhealthcare.com, franklinpharlacyandhealthcare.com, franklinpharmqcyandhealthcare.com, franklinpharmwcyandhealthcare.com, franklinpharmzcyandhealthcare.com, franklinpharmxcyandhealthcare.com, franklinpharmaxyandhealthcare.com, franklinpharmasyandhealthcare.com, franklinpharmadyandhealthcare.com, franklinpharmafyandhealthcare.com, franklinpharmavyandhealthcare.com, franklinpharmactandhealthcare.com, franklinpharmacgandhealthcare.com, franklinpharmachandhealthcare.com, franklinpharmacjandhealthcare.com, franklinpharmacuandhealthcare.com, franklinpharmacyqndhealthcare.com, franklinpharmacywndhealthcare.com, franklinpharmacyzndhealthcare.com, franklinpharmacyxndhealthcare.com, franklinpharmacyabdhealthcare.com, franklinpharmacyagdhealthcare.com, franklinpharmacyahdhealthcare.com, franklinpharmacyajdhealthcare.com, franklinpharmacyamdhealthcare.com, franklinpharmacyanxhealthcare.com, franklinpharmacyanshealthcare.com, franklinpharmacyanwhealthcare.com, franklinpharmacyanehealthcare.com, franklinpharmacyanrhealthcare.com, franklinpharmacyanfhealthcare.com, franklinpharmacyanvhealthcare.com, franklinpharmacyanchealthcare.com, franklinpharmacyandbealthcare.com, franklinpharmacyandgealthcare.com, franklinpharmacyandtealthcare.com, franklinpharmacyandyealthcare.com, franklinpharmacyanduealthcare.com, franklinpharmacyandjealthcare.com, franklinpharmacyandmealthcare.com, franklinpharmacyandnealthcare.com, franklinpharmacyandhwalthcare.com, franklinpharmacyandhsalthcare.com, franklinpharmacyandhdalthcare.com, franklinpharmacyandhfalthcare.com, franklinpharmacyandhralthcare.com, franklinpharmacyandheqlthcare.com, franklinpharmacyandhewlthcare.com, franklinpharmacyandhezlthcare.com, franklinpharmacyandhexlthcare.com, franklinpharmacyandheapthcare.com, franklinpharmacyandheaothcare.com, franklinpharmacyandheaithcare.com, franklinpharmacyandheakthcare.com, franklinpharmacyandheamthcare.com, franklinpharmacyandhealrhcare.com, franklinpharmacyandhealfhcare.com, franklinpharmacyandhealghcare.com, franklinpharmacyandhealhhcare.com, franklinpharmacyandhealyhcare.com, franklinpharmacyandhealtbcare.com, franklinpharmacyandhealtgcare.com, franklinpharmacyandhealttcare.com, franklinpharmacyandhealtycare.com, franklinpharmacyandhealtucare.com, franklinpharmacyandhealtjcare.com, franklinpharmacyandhealtmcare.com, franklinpharmacyandhealtncare.com, franklinpharmacyandhealthxare.com, franklinpharmacyandhealthsare.com, franklinpharmacyandhealthdare.com, franklinpharmacyandhealthfare.com, franklinpharmacyandhealthvare.com, franklinpharmacyandhealthcqre.com, franklinpharmacyandhealthcwre.com, franklinpharmacyandhealthczre.com, franklinpharmacyandhealthcxre.com, franklinpharmacyandhealthcaee.com, franklinpharmacyandhealthcade.com, franklinpharmacyandhealthcafe.com, franklinpharmacyandhealthcage.com, franklinpharmacyandhealthcate.com, franklinpharmacyandhealthcarw.com, franklinpharmacyandhealthcars.com, franklinpharmacyandhealthcard.com, franklinpharmacyandhealthcarf.com, franklinpharmacyandhealthcarr.com,Whois Record of franklinpharmacyandhealthcare.com
Domain Name: FRANKLINPHARMACYANDHEALTHCARE.COM
Registry Domain ID: 102119557_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2018-07-17T07:52:02Z
Creation Date: 2003-08-15T17:33:18Z
Registry Expiry Date: 2019-08-15T17:33:18Z
Registrar: eNom, LLC
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS1.NAME-SERVICES.COM
Name Server: DNS2.NAME-SERVICES.COM
Name Server: DNS3.NAME-SERVICES.COM
Name Server: DNS4.NAME-SERVICES.COM
Name Server: DNS5.NAME-SERVICES.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-04-25T08:00:12Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
Registry Domain ID: 102119557_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2018-07-17T07:52:02Z
Creation Date: 2003-08-15T17:33:18Z
Registry Expiry Date: 2019-08-15T17:33:18Z
Registrar: eNom, LLC
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS1.NAME-SERVICES.COM
Name Server: DNS2.NAME-SERVICES.COM
Name Server: DNS3.NAME-SERVICES.COM
Name Server: DNS4.NAME-SERVICES.COM
Name Server: DNS5.NAME-SERVICES.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-04-25T08:00:12Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.